PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P14600_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 388aa    MW: 42688.8 Da    PI: 6.886
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P14600_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14e-102833182055
                            HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            +k +yps++e++ LA+++gL+++q+++WF N+R ++
  GSMUA_Achr4P14600_001 283 HKWPYPSESEKRALAESTGLDQKQISNWFINQRKRH 318
                            5679*****************************885 PP

2ELK231.8e-08237258122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELK+ Ll+ Ysg+ +sL+qE+s
  GSMUA_Achr4P14600_001 237 ELKNFLLKRYSGHMNSLRQELS 258
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-1894138IPR005540KNOX1
PfamPF037906.9E-2195136IPR005540KNOX1
SMARTSM012561.1E-23145196IPR005541KNOX2
PfamPF037912.3E-23149195IPR005541KNOX2
SMARTSM011882.6E-4237258IPR005539ELK domain
PfamPF037891.3E-8237258IPR005539ELK domain
PROSITE profilePS5121310.057237257IPR005539ELK domain
PROSITE profilePS5007113.928258321IPR001356Homeobox domain
SuperFamilySSF466891.63E-19259332IPR009057Homeodomain-like
SMARTSM003891.1E-14260325IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.0E-28263326IPR009057Homeodomain-like
CDDcd000868.88E-13270321No hitNo description
PfamPF059202.8E-16278317IPR008422Homeobox KN domain
PROSITE patternPS000270296319IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEELYQVEVY QRDATGLIQT SSPSLAASAT TSKVLTVAAV AAPPAFFHGK AHCWADPLSF  60
TTTHHHPLHL ETSSSSSPQD AFQRRAAASS SDIDTIKASI ISHPQYSSLL SAYVNCQKIG  120
APPAVADRLS ATAGELEARQ RAALSSSHPL TDPDLDRFME AYCQVLVKYK EELTRPVEEA  180
KEFLRRAESQ LNSITDGSLH LLSSDENSGG CSSAEDQEAG GSKTRLPKID QCGEEVELKN  240
FLLKRYSGHM NSLRQELSKK KKKKGKLPKE AIEKLLSWWE LHHKWPYPSE SEKRALAEST  300
GLDQKQISNW FINQRKRHWK PAKDEQFIMT DGYDPSNAAA LHADGGFMSD GRFSNSVWSS  360
TPSSASPVVL VVTLTSGTVE LSSRATLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396452.10.0PREDICTED: homeobox protein knotted-1-like 6 isoform X2
SwissprotP466091e-107KNOS6_ORYSJ; Homeobox protein knotted-1-like 6
TrEMBLM0SNX50.0M0SNX5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P14600_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-103KNOTTED-like from Arabidopsis thaliana